Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002006231.1 |
sequence |
PEP: >XP_002006231.1 MTEKLSYGPPVDSDDSDCSSYDGFYFSEPLKREKRAPCVQPQQLLYEALMEGNLQLVREHIDALKFPVDGILSGGLTMLM |
Swiss-Prot | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 |
KEGG | K18410 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF00536 SAM_1; SAM domain (Sterile alpha motif) |
SMART | SM00248 |
ProSiteProfiles | PS50088 ANK_REPEAT; Ankyrin repeat profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
