Gene detail [Fasta]
| Species | Drosophila mojavensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002003917.1 |
| sequence |
PEP: >XP_002003917.1 MAAEIKPAQRSNNDRFLSTKKPELLSKLEGSGDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMPSGCT |
| Swiss-Prot | WD repeat and FYVE domain-containing protein 2 |
| SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
| Gene3D | G3DSA:3.30.40.10 |
| Pfam | PF01363 FYVE; FYVE zinc finger |
| SMART | SM00320 |
| ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
| PRINTS | PR00320 |
| ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers
You might be interested in these references
