Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002003708.1 |
sequence |
PEP: >XP_002003708.1 MEPTLDHYKISCELLGHSLDVRAVAAGGNAEGAGQIIVSGSRDKSTKLWKPISGNEYIESVTLQDHKNFISYICYLESEQ |
Swiss-Prot | Phospholipase A-2-activating protein |
KEGG | K14018 PLAA, DOA1, UFD3; phospholipase A-2-activating protein |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF09070 PFU; PFU (PLAA family ubiquitin binding) |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
Coils | Coil |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
