Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002001875.1 |
sequence |
PEP: >XP_002001875.1 MSEMQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYLLCDYNRDGDSYRSPWSNTYY |
Swiss-Prot | F-actin-capping protein subunit beta |
KEGG | K10365 |
SUPERFAMILY | SSF90096 Subunits of heterodimeric actin filament capping protein Capz superfamily |
Pfam | PF01115 F_actin_cap_B; F-actin capping protein, beta subunit |
PRINTS | PR00192 |
Coils | Coil |
ProSitePatterns | PS00231 F_ACTIN_CAPPING_BETA; F-actin capping protein beta subunit signature. |
You might be interested in these researchers

You might be interested in these references
