Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Drosophila mojavensis
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_002001796.1
sequence PEP: 
>XP_002001796.1
MSASPTARQAISHAEPMAMTKTKKIVISDPIQMPEVYSSTPGGTLYSTTPGGTKLIYERTFMKNLRSSPLSQTPPSNIPS
CLMRGTPRTPFRKCVPVPTDLVKKTQSLKIEEQEQFQLDL
Swiss-ProtEukaryotic translation initiation factor 4E-binding protein 2
KEGG     K18644  EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2     
PfamPF05456  eIF_4EBP; Eukaryotic translation initiation factor 4E binding protein (EIF4EBP)     

You might be interested in these researchers

You might be interested in these references