Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002000756.1 |
sequence |
PEP: >XP_002000756.1 MLEYEIYELKEEQVRLPPISSNNTTTNNKSPKTRQNTYILLKSNTLLKSKASTTSATTTESGEPSLPAPTCSVIYPEIQE |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 1 |
KEGG | K11832 USP1; ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12] |
SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
Coils | Coil |
ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
You might be interested in these researchers

You might be interested in these references
