Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002000274.1 |
sequence |
PEP: >XP_002000274.1 MAQLKKLHMADKLEDLEKWTEIKDVRNKSMKILLNTARKLYLTAEQYRRDGDQELAYITYVKYFNMLAAIREKSDYNQHK |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 8 |
KEGG | K11839 USP8, UBP5; ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12] |
SUPERFAMILY | SSF140856 USP8 N-terminal domain-like superfamily |
Gene3D | G3DSA:3.40.250.10 |
Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
ProSiteProfiles | PS50206 RHODANESE_3; Rhodanese domain profile. |
Coils | Coil |
ProSitePatterns | PS00972 USP_1; Ubiquitin specific protease (USP) domain signature 1. |
You might be interested in these researchers

You might be interested in these references
