Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001999120.1 |
sequence |
PEP: >XP_001999120.1 MTHLGEEDSPVEEKKKPRGIVRESSQIFRRNRALGYVSNHVPAVTRYVQRRRDTLLITCIGRSFQVYTASHMRLLHVSGL |
Swiss-Prot | WD repeat-containing protein 36 |
KEGG | K14554 UTP21, WDR36; U3 small nucleolar RNA-associated protein 21 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF04192 Utp21; Utp21 specific WD40 associated putative domain |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
