Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001998697.1 |
sequence |
PEP: >XP_001998697.1 MQAKDRLRREYSSFNDLSRQFRMYDEQSIDSLLDDRLRIHMNPNGSDDISLQRDDCYTPIYPAAQPQSPLLLLRQHNFKL |
Swiss-Prot | GTPase-activating protein RacGAP84C |
KEGG | K16733 |
SUPERFAMILY | SSF48350 GTPase activation domain, GAP superfamily |
Gene3D | G3DSA:1.10.555.10 |
Pfam | PF00620 RhoGAP; RhoGAP domain |
SMART | SM00109 |
ProSiteProfiles | PS50238 RHOGAP; Rho GTPase-activating proteins domain profile. |
ProSitePatterns | PS00479 ZF_DAG_PE_1; Zinc finger phorbol-ester/DAG-type signature. |
You might be interested in these researchers

You might be interested in these references
