Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012248399.1 |
sequence |
PEP: >XP_012248399.1 MIKLENVSKIFYQNNQPVTALNNINLSVPVGQIFGVIGTSGAGKSTLIRCVNLLERPSSGKVIVDGVDLTALSNRKLTKI |
Swiss-Prot | Methionine import ATP-binding protein MetN 3 |
KEGG | K02071 metN; D-methionine transport system ATP-binding protein |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.30.70.260 |
Pfam | PF00005 ABC_tran; ABC transporter |
SMART | SM00382 |
ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
PANTHER | PTHR24220:SF186 |
You might be interested in these researchers

You might be interested in these references
