Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012247561.1 |
sequence |
PEP: >XP_012247561.1 MDDENKNNEFRNKDCIFLERKNKIEDGYSTVNVEPLRFVKNVRMKDQINGDIQEEGFSSFNMQEDKDFRCPRCGQSMQEP |
Swiss-Prot | Tripartite motif-containing protein 45 |
SUPERFAMILY | SSF57850 RING/U-box superfamily |
Gene3D | G3DSA:4.10.45.10 |
Pfam | PF00643 zf-B_box; B-box zinc finger |
SMART | SM00184 |
ProSiteProfiles | PS50119 ZF_BBOX; Zinc finger B-box type profile. |
ProSitePatterns | PS00518 ZF_RING_1; Zinc finger RING-type signature. |
PANTHER | PTHR24103:SF244 |
You might be interested in these researchers

You might be interested in these references
