Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012244287.1 |
sequence |
PEP: >XP_012244287.1 MSKMYTTANLSDKELKEEGNRLFNLHKYEDAAHCYTKAIIKNPTQALYFTNRALCNLKLKRWESSCLDCRRALDIDPCLV |
Swiss-Prot | STIP1 homology and U box-containing protein 1 |
KEGG | K09561 STUB1, CHIP; STIP1 homology and U-box containing protein 1 [EC:6.3.2.19] |
SUPERFAMILY | SSF57850 RING/U-box superfamily |
Gene3D | G3DSA:1.25.40.10 |
Pfam | PF00515 TPR_1; Tetratricopeptide repeat |
SMART | SM00504 |
ProSiteProfiles | PS50293 TPR_REGION; TPR repeat region circular profile. |
Coils | Coil |
PANTHER | PTHR22904:SF305 |
You might be interested in these researchers

You might be interested in these references
