Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012242474.1 |
sequence |
PEP: >XP_012242474.1 MNRVMAVRLENNNAGVVLATCRTVLLVFVAVLVLANADQNQSGLKVEKLYVPEVCDAKSKIGDQLTMHYTGTLVDGTKFD |
Swiss-Prot | FK506-binding protein 2 |
KEGG | K09577 |
SUPERFAMILY | SSF54534 FKBP-like superfamily |
Gene3D | G3DSA:3.10.50.40 |
Pfam | PF00254 FKBP_C; FKBP-type peptidyl-prolyl cis-trans isomerase |
SMART | SM00054 |
ProSiteProfiles | PS50222 EF_HAND_2; EF-hand calcium-binding domain profile. |
ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
PANTHER | PTHR10516:SF252 |
You might be interested in these researchers

You might be interested in these references
