Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR08949.1 |
| sequence |
PEP: >KDR08949.1 MFTICPDCLHVFPNPNSSNNHQQQQQQFTTPILSPSSAPTVPFTPPCCESNRQQQQQQQQPLLISLQLPPWTSAVTTYTV |
| Swiss-Prot | Cytokine-inducible SH2-containing protein |
| KEGG | K04695 SOCS2, CIS2; suppressor of cytokine signaling 2 |
| SUPERFAMILY | SSF158235 SOCS box-like superfamily |
| Gene3D | G3DSA:3.30.505.10 |
| Pfam | PF00017 SH2; SH2 domain |
| SMART | SM00252 |
| ProSiteProfiles | PS50001 SH2; Src homology 2 (SH2) domain profile. |
| PANTHER | PTHR10385:SF17 |
You might be interested in these researchers
You might be interested in these references
