Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003493425.1 |
sequence |
PEP: >XP_003493425.1 MIGIPRDDRHKITVKIRNNMKRSSSRDTPPRVKRSRSSMGRYDDSSDERITPERIRRRSRGARSPSPPTRASSHARYVES |
Swiss-Prot | Putative RNA-binding protein 15B |
KEGG | K13190 |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:3.30.70.330 |
Pfam | PF14259 RRM_6; RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) |
SMART | SM00360 |
ProSiteProfiles | PS50917 SPOC; SPOC domain profile. |
PANTHER | PTHR23189:SF41 |
You might be interested in these researchers

You might be interested in these references
