Gene detail [Fasta]
| Species | Bombus impatiens |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003489666.1 |
| sequence |
PEP: >XP_003489666.1 MTGFTESALVKRLMDLNPSQQSIQTLSLWLIHHRKHHPTIVKVWFKEMCKVKDNRKLMFMYLANDVIQNSKKKGPEFGKE |
| Swiss-Prot | Regulation of nuclear pre-mRNA domain-containing protein 1B |
| KEGG | K15559 |
| SUPERFAMILY | SSF48464 ENTH/VHS domain superfamily |
| Gene3D | G3DSA:1.25.40.90 |
| Pfam | PF04818 CTD_bind; RNA polymerase II-binding domain. |
| SMART | SM00582 |
| ProSiteProfiles | PS51391 CID; CID domain profile. |
| Coils | Coil |
| PANTHER | PTHR12460:SF1 |
You might be interested in these researchers
You might be interested in these references
