Gene detail [Fasta]
Species | Bombus impatiens |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003488320.1 |
sequence |
PEP: >XP_003488320.1 MPGLIAVSEFVEETREDYNSPTTSTFVSRMPQCRQTITSLEETLDFDRDGLTKLKKAIKAIHNSGNAHVDNEVYLGRALE |
Swiss-Prot | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 |
KEGG | K12488 ASAP; Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF48403 Ankyrin repeat superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00105 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00405 |
Coils | Coil |
PANTHER | PTHR23180:SF17 |