Gene detail [Fasta]
| Species | Drosophila ananassae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001966580.1 |
| sequence |
PEP: >XP_001966580.1 MSVCYLEVHAKHSKQLLLRGKLKSTKVPSHCFPVYTDNNVPVPGDHNDNHLVASGEAKCFHSGRFYNESEQWRSAQDSCQ |
| Swiss-Prot | Dorsal-ventral patterning protein Sog |
| KEGG | K04657 CHRD; chordin |
| SUPERFAMILY | SSF57603 FnI-like domain superfamily |
| Gene3D | G3DSA:2.10.70.10 |
| Pfam | PF00093 VWC; von Willebrand factor type C domain |
| SMART | SM00214 |
| ProSiteProfiles | PS50184 VWFC_2; VWFC domain profile. |
| ProSitePatterns | PS01208 VWFC_1; VWFC domain signature. |
| PANTHER | PTHR11339 |
You might be interested in these researchers
You might be interested in these references
