Gene detail [Fasta]
| Species | Drosophila ananassae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001963900.1 |
| sequence |
PEP: >XP_001963900.1 MDLGDSKLRAVRVLGQGSFGRVFLCYQSGRQVCVKRIIVRNPKTELGLIKEEVYIISQLRHPHIVQFLRSFTHAGTVNIV |
| Swiss-Prot | CBL-interacting protein kinase 25 |
| KEGG | K08286 |
| SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
| Gene3D | G3DSA:3.30.200.20 |
| Pfam | PF00069 Pkinase; Protein kinase domain |
| SMART | SM00220 |
| ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
| ProSitePatterns | PS00108 PROTEIN_KINASE_ST; Serine/Threonine protein kinases active-site signature. |
| PANTHER | PTHR24362 |
You might be interested in these researchers
You might be interested in these references
