Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Drosophila ananassae
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_001961236.1
sequence PEP:
>XP_001961236.1
MFGLTSSAAPRKYNLRTQDSASEYPSISRPRTRRSGEGSEPKSENEEPAADNGSAKGSKKSTAPATSDAMIALQQLASIS
TARSLQHLVQNMGGIMDTNSLIIGPKLPRQSSKRSPTYESNRCPLCARVYRSQAFLNEHMRKEHSVLI
Swiss-ProtPOZ-, AT hook-, and zinc finger-containing protein 1
ProSiteProfilesPS50157  ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile.     
ProSitePatternsPS00028  ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature.     

You might be interested in these researchers

You might be interested in these references