Gene detail [Fasta]
| Species | Drosophila ananassae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001959669.1 |
| sequence |
PEP: >XP_001959669.1 MWSSSSGYLVLFGVFLLATSLAAQKNTSNVVCYQGTWSTYRPGLGKFGVEDIDPFLCTHLIYAFLGIEETGQLRVIDAYL |
| Swiss-Prot | Acidic mammalian chitinase |
| KEGG | K01183 E3.2.1.14; chitinase [EC:3.2.1.14] |
| SUPERFAMILY | SSF51445 (Trans)glycosidases superfamily |
| Gene3D | G3DSA:3.10.50.10 |
| Pfam | PF01607 CBM_14; Chitin binding Peritrophin-A domain |
| SMART | SM00636 |
| ProSiteProfiles | PS50940 CHIT_BIND_II; Chitin-binding type-2 domain profile. |
| ProSitePatterns | PS01095 CHITINASE_18; Chitinases family 18 active site. |
| PANTHER | PTHR11177:SF112 |
You might be interested in these researchers
You might be interested in these references
