Gene detail [Fasta]
| Species | Drosophila ananassae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001959177.1 |
| sequence |
PEP: >XP_001959177.1 MLFFCPSCGNILIIEEDTSCHRFTCNTCPYISKIKRKITAKTFPRLKEVDHVLGGKAAWENVDSTDAECPQCSHKRAYFM |
| Swiss-Prot | YrdC domain-containing protein, mitochondrial |
| SUPERFAMILY | SSF55821 YrdC/RibB superfamily |
| Gene3D | G3DSA:2.20.25.10 |
| Pfam | PF01096 TFIIS_C; Transcription factor S-II (TFIIS) |
| SMART | SM00661 |
| ProSiteProfiles | PS51133 ZF_TFIIS_2; Zinc finger TFIIS-type profile. |
| ProSitePatterns | PS01030 RNA_POL_M_15KD; RNA polymerases M / 15 Kd subunits signature. |
| TIGRFAM | TIGR00057 |
| PANTHER | PTHR17490 |
You might be interested in these researchers
You might be interested in these references
