Gene detail [Fasta]
| Species | Drosophila ananassae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001958535.1 |
| sequence |
PEP: >XP_001958535.1 MSAPGMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAEKFKEVNRAHSILSDQTKRNIYDN |
| Swiss-Prot | Cysteine string protein |
| KEGG | K09525 DNAJC5; DnaJ homolog subfamily C member 5 |
| SUPERFAMILY | SSF46565 Chaperone J-domain superfamily |
| Gene3D | G3DSA:1.10.287.110 |
| Pfam | PF00226 DnaJ; DnaJ domain |
| SMART | SM00271 |
| ProSiteProfiles | PS50076 DNAJ_2; dnaJ domain profile. |
| PRINTS | PR00625 |
| ProSitePatterns | PS00636 DNAJ_1; Nt-dnaJ domain signature. |
| PANTHER | PTHR24078 |
You might be interested in these researchers
You might be interested in these references
