Gene detail [Fasta]
Species | Drosophila ananassae |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001955010.1 |
sequence |
PEP: >XP_001955010.1 MESTNDLTDELIRRLSVSGVLEEVIPSNMFEETNIYDDSNDVETEAEPDDIIIVHMDIREPLSTLKKLVERKIGVVLNYY |
Swiss-Prot | DNA-binding protein Ets97D |
KEGG | K09441 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.10.150.50 |
Pfam | PF02198 SAM_PNT; Sterile alpha motif (SAM)/Pointed domain |
SMART | SM00413 |
ProSiteProfiles | PS51433 PNT; Pointed (PNT) domain profile. |
PRINTS | PR00454 |
ProSitePatterns | PS00345 ETS_DOMAIN_1; Ets-domain signature 1. |
PIRSF | PIRSF001703 |
PANTHER | PTHR11849:SF28 |
You might be interested in these researchers

You might be interested in these references
