Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012350656.1 |
sequence |
PEP: >XP_012350656.1 MKEISNCDDIPGTIVVRVGNNRPDLGTNPICNRFTGPLEEGQPLFLPCNPPMPGAFVSVHLEANTPTPIPVQLSLCEAFV |
Swiss-Prot | Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 |
SUPERFAMILY | SSF56436 C-type lectin-like superfamily |
Gene3D | G3DSA:3.10.100.10 |
Pfam | PF00084 Sushi; Sushi repeat (SCR repeat) |
SMART | SM00607 |
ProSiteProfiles | PS50923 SUSHI; Sushi/CCP/SCR domain profile. |
ProSitePatterns | PS00615 C_TYPE_LECTIN_1; C-type lectin domain signature. |
PANTHER | PTHR19325:SF339 |
You might be interested in these researchers

You might be interested in these references
