Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Apis florea
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_012349863.1
sequence PEP:
>XP_012349863.1
MRKDSLQRHVHWECGKEPQFQCPFCPQRCKRKAHWLRHIRRQHLDKIGDMEAYLLAYTPKLEID
Swiss-ProtLongitudinals lacking protein, isoforms A/B/D/L
PfamPF00096  zf-C2H2; Zinc finger, C2H2 type     
ProSitePatternsPS00028  ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature.     

You might be interested in these researchers

You might be interested in these references