Gene detail [Fasta]
Species | Zootermopsis nevadensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR23117.1 |
sequence |
PEP: >KDR23117.1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDPSVRSVMHRYLEKKNEVNFDKIFNQMLGYLLFKDFCETMAEEPV |
Swiss-Prot | G protein-coupled receptor kinase 1 |
KEGG | K00910 ADRBK, GRK; beta-adrenergic-receptor kinase [EC:2.7.11.15] |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00069 Pkinase; Protein kinase domain |
SMART | SM00220 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
PRINTS | PR00717 |
Coils | Coil |
ProSitePatterns | PS00108 PROTEIN_KINASE_ST; Serine/Threonine protein kinases active-site signature. |
PANTHER | PTHR24355:SF18 |
You might be interested in these researchers

You might be interested in these references
