Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012343685.1 |
sequence |
PEP: >XP_012343685.1 MDLLPEHNSTFWKIGRLKTFEDWPFQSSDNSCNPERMAAAGFYVVGGKKEPDLVECFICSKQLDSWDPDDDPWNEHMKHE |
Swiss-Prot | Baculoviral IAP repeat-containing protein 5 |
KEGG | K08731 BIRC5; baculoviral IAP repeat-containing protein 5 |
SUPERFAMILY | SSF57924 Inhibitor of apoptosis (IAP) repeat superfamily |
Gene3D | G3DSA:1.10.1170.10 |
Pfam | PF00653 BIR; Inhibitor of Apoptosis domain |
SMART | SM00238 |
ProSiteProfiles | PS50143 BIR_REPEAT_2; BIR repeat profile. |
PANTHER | PTHR10044:SF88 |
You might be interested in these researchers

You might be interested in these references
