Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012341982.1 |
| sequence |
PEP: >XP_012341982.1 MESMVEENGSAVDPLSAGSQSGDAAPAIATSVQSVIQPNQQSVIQTATNIQPVAISKGNVILVSKPNSVIQTAQASLQTL |
| Swiss-Prot | Cyclic AMP-responsive element-binding protein 1 |
| KEGG | K09050 |
| SUPERFAMILY | SSF57959 Leucine zipper domain superfamily |
| Gene3D | G3DSA:1.20.5.170 |
| Pfam | PF00170 bZIP_1; bZIP transcription factor |
| SMART | SM00338 |
| ProSiteProfiles | PS50217 BZIP; Basic-leucine zipper (bZIP) domain profile. |
| PRINTS | PR00041 |
| Coils | Coil |
| ProSitePatterns | PS00036 BZIP_BASIC; Basic-leucine zipper (bZIP) domain signature. |
| PANTHER | PTHR22952:SF104 |
You might be interested in these researchers
You might be interested in these references
