Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012341917.1 |
sequence |
PEP: >XP_012341917.1 MCVLIVGQKVNPEWASYNIGIFVCTRCAGIHRSMGAHISKVKHLKLDRWEDSQVNRIREVGNIAARLHYEERVPPCYRRP |
Swiss-Prot | Arf-GAP with dual PH domain-containing protein 1 |
SUPERFAMILY | SSF57863 ArfGap/RecO-like zinc finger superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00233 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
PRINTS | PR00405 |
PANTHER | PTHR23180:SF219 |
You might be interested in these researchers

You might be interested in these references
