Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012341375.1 |
sequence |
PEP: >XP_012341375.1 MSWDLKNWPIFSFLDLNYVSKIHMALVYGNFGNEALIVTKDKMVYAVGSNTSGCLGTGDTYNTLYPRRVEELCGKDIKTF |
Swiss-Prot | RCC1 and BTB domain-containing protein 1 |
SUPERFAMILY | SSF50985 RCC1/BLIP-II superfamily |
Gene3D | G3DSA:2.130.10.30 |
Pfam | PF00651 BTB; BTB/POZ domain |
ProSiteProfiles | PS50097 BTB; BTB domain profile. |
PRINTS | PR00633 |
ProSitePatterns | PS00626 RCC1_2; Regulator of chromosome condensation (RCC1) signature 2. |
PANTHER | PTHR22870:SF132 |
You might be interested in these researchers

You might be interested in these references
