Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012340943.1 |
| sequence |
PEP: >XP_012340943.1 MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDDDKRGFIKLVYQNIFMA |
| Swiss-Prot | G protein alpha q subunit |
| KEGG | K04634 GNAQ; guanine nucleotide-binding protein G(q) subunit alpha |
| SUPERFAMILY | SSF47895 Transducin (alpha subunit), insertion domain superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF00503 G-alpha; G-protein alpha subunit |
| SMART | SM00275 |
| PRINTS | PR00442 |
| Coils | Coil |
| PANTHER | PTHR10218 |
You might be interested in these researchers
You might be interested in these references
