Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012340563.1 |
sequence |
PEP: >XP_012340563.1 MAHNLAPSVNCSLDDIDLNALKEPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEYSNHRNIATYYGAFVKK |
Swiss-Prot | Traf2 and NCK-interacting protein kinase |
KEGG | K04413 |
SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
Gene3D | G3DSA:3.30.200.20 |
Pfam | PF00069 Pkinase; Protein kinase domain |
SMART | SM00220 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
PANTHER | PTHR24361:SF196 |
You might be interested in these researchers

You might be interested in these references
