Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012339114.1 |
sequence |
PEP: >XP_012339114.1 MYAPVGEGHGNQQPSLVNSWWLHPPGVTFKAHRLILAACSKHFQELFEGMPPSPAGLIVILDGTSAHNMASLLEFMYRGE |
Swiss-Prot | Longitudinals lacking protein-like |
SUPERFAMILY | SSF57667 beta-beta-alpha zinc fingers superfamily |
Gene3D | G3DSA:3.30.710.10 |
Pfam | PF13894 zf-C2H2_4; C2H2-type zinc finger |
SMART | SM00355 |
ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
PANTHER | PTHR23110:SF61 |
You might be interested in these researchers

You might be interested in these references
