Gene detail [Fasta]
Species | Apis florea |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003695353.1 |
sequence |
PEP: >XP_003695353.1 MSGGVVPSKSTVYISNLPFSLTNNDIHQLLQSYGKIVKVTVMKDKITRKSRGVAFVLFLTPEDAITCAKNLNNTEIGGRT |
Swiss-Prot | Zinc finger CCHC-type and RNA-binding motif-containing protein 1 |
KEGG | K13154 |
SUPERFAMILY | SSF57756 Retrovirus zinc finger-like domains superfamily |
Gene3D | G3DSA:4.10.60.10 |
Pfam | PF00076 RRM_1; RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
SMART | SM00360 |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
Coils | Coil |
PANTHER | PTHR23139:SF52 |
You might be interested in these researchers

You might be interested in these references
