Gene detail [Fasta]
Species | Zootermopsis nevadensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR22121.1 |
sequence |
PEP: >KDR22121.1 MPPKDDPELQKLRKELDDMMKKIKEEQDKVADKTLQDICGDMADAPKVRLTTKKLLKGHINKVNSVHFSGDSRHAVTGSL |
Swiss-Prot | Guanine nucleotide-binding protein subunit beta-2 |
KEGG | K07972 GNB; guanine nucleotide-binding protein subunit beta, other |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
PRINTS | PR00320 |
Coils | Coil |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
PIRSF | PIRSF002394 |
PANTHER | PTHR19850:SF30 |
You might be interested in these researchers

You might be interested in these references
