Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003689805.1 |
| sequence |
PEP: >XP_003689805.1 MTEQQMDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDKESGKDYLLCDYNRDGDSYRSPWSNTYD |
| Swiss-Prot | F-actin-capping protein subunit beta |
| KEGG | K10365 |
| SUPERFAMILY | SSF90096 Subunits of heterodimeric actin filament capping protein Capz superfamily |
| Pfam | PF01115 F_actin_cap_B; F-actin capping protein, beta subunit |
| PRINTS | PR00192 |
| Coils | Coil |
| ProSitePatterns | PS00231 F_ACTIN_CAPPING_BETA; F-actin capping protein beta subunit signature. |
| PANTHER | PTHR10619 |
You might be interested in these researchers
You might be interested in these references
