Gene detail [Fasta]
Species | Bactrocera cucurbitae |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011191204.1 |
sequence |
PEP: >XP_011191204.1 MGCTTSAEERAALQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTPEDFKQYRPVVYSNTIQS |
Swiss-Prot | Guanine nucleotide-binding protein G(o) subunit alpha |
KEGG | K04534 GNAO, G-ALPHA-O; guanine nucleotide-binding protein G(o) subunit alpha |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:1.10.400.10 |
Pfam | PF00503 G-alpha; G-protein alpha subunit |
SMART | SM00275 |
PRINTS | PR00441 |
PANTHER | PTHR10218:SF203 |
You might be interested in these researchers

You might be interested in these references
