Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR21274.1 |
| sequence |
PEP: >KDR21274.1 MVKQVPIVYWEDSGLNLRVSHEHLQHLITEYNAANPSGPDMTLEEDGSTFRGFIRVHMNLCRPISVVAGTRPPSIYDILK |
| Swiss-Prot | Ras association domain-containing protein 1 |
| KEGG | K08015 RASSF5, RAPL; Ras association domain-containing protein 5 |
| SUPERFAMILY | SSF54236 Ubiquitin-like superfamily |
| Gene3D | G3DSA:3.10.20.90 |
| Pfam | PF00788 RA; Ras association (RalGDS/AF-6) domain |
| SMART | SM00314 |
| ProSiteProfiles | PS50200 RA; Ras-associating (RA) domain profile. |
| Coils | Coil |
| PANTHER | PTHR22738 |
You might be interested in these researchers
You might be interested in these references
