Gene detail [Fasta]
Species | Bactrocera cucurbitae |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011187767.1 |
sequence |
PEP: >XP_011187767.1 MEIEPDQSIEAMDTQEVEIITSDLPNQQQQPLNKLHLPAEQLPNENGNGPPQQLLADTTSPYANEQEMTSVDDPKDDQFR |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 7 |
KEGG | K11838 USP7, UBP15; ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12] |
SUPERFAMILY | SSF49599 TRAF domain-like superfamily |
Gene3D | G3DSA:2.60.210.10 |
Pfam | PF14533 USP7_C2; Ubiquitin-specific protease C-terminal |
SMART | SM00061 |
ProSiteProfiles | PS50144 MATH; MATH/TRAF domain profile. |
Coils | Coil |
ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
PANTHER | PTHR24006:SF89 |
You might be interested in these researchers

You might be interested in these references
