Gene detail [Fasta]
Species | Bactrocera cucurbitae |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011184748.1 |
sequence |
PEP: >XP_011184748.1 MWKCHKCGKPVYFAERKQSLGYDWHPECLRCEECGKRLNPGQHAEHKGVPYCHVPCYGALFGPQLFGHGTRVESHKSYGV |
Swiss-Prot | Ras association domain-containing protein 2 |
KEGG | K09851 RASSF2_4; Ras association domain-containing protein 2/4 |
SUPERFAMILY | SSF57716 Glucocorticoid receptor-like (DNA-binding domain) superfamily |
Gene3D | G3DSA:2.10.110.10 |
Pfam | PF00788 RA; Ras association (RalGDS/AF-6) domain |
SMART | SM00132 |
ProSiteProfiles | PS50951 SARAH; SARAH domain profile. |
Coils | Coil |
ProSitePatterns | PS00478 LIM_DOMAIN_1; LIM zinc-binding domain signature. |
PANTHER | PTHR22738:SF13 |
You might be interested in these researchers

You might be interested in these references
