Gene detail [Fasta]
| Species | Bactrocera cucurbitae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011183781.1 |
| sequence |
PEP: >XP_011183781.1 MMEPKSENQLDEVQRQIFERIAKNDVNGFKQLITQLKAGVDFVDDDGMTPLQHACCKGNKEAVQMLLDMGADINFNKHGA |
| Swiss-Prot | Ankyrin repeat and MYND domain-containing protein 2 |
| SUPERFAMILY | SSF144232 HIT/MYND zinc finger-like superfamily |
| Gene3D | G3DSA:1.25.40.20 |
| Pfam | PF12796 Ank_2; Ankyrin repeats (3 copies) |
| SMART | SM00248 |
| ProSiteProfiles | PS50297 ANK_REP_REGION; Ankyrin repeat region circular profile. |
| ProSitePatterns | PS01360 ZF_MYND_1; Zinc finger MYND-type signature. |
| PANTHER | PTHR24150 |
You might be interested in these researchers
You might be interested in these references
