Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR07690.1 |
| sequence |
PEP: >KDR07690.1 MDSSAIKVRQEFSVQTDNLHKSDRSVSKVNPKYYKQSYRIEWESMPDFKGWLKGVPGEPNRAYCLFCKKSLHAHRLSLLK |
| Swiss-Prot | 5-hydroxyisourate hydrolase |
| KEGG | K07127 uraH, pucM, hiuH; 5-hydroxyisourate hydrolase [EC:3.5.2.17] |
| SUPERFAMILY | SSF49472 Transthyretin (synonym: prealbumin) superfamily |
| Gene3D | G3DSA:2.60.40.180 |
| Pfam | PF00576 Transthyretin; HIUase/Transthyretin family |
| SMART | SM00095 |
| PRINTS | PR00189 |
| ProSitePatterns | PS00769 TRANSTHYRETIN_2; Transthyretin signature 2. |
| TIGRFAM | TIGR02962 |
| PANTHER | PTHR10395 |
You might be interested in these researchers
You might be interested in these references
