Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Zootermopsis nevadensis
GenBankhttp://www.ncbi.nlm.nih.gov/protein/KDR20356.1
sequence PEP:
>KDR20356.1
MVTTYDNISNYITTMKAQEETIMADVRDILELERPPTPEITKEAILGSEKVKKKPITTKVSKRPEGMHREVFALLYTDNK
DAPPLFPTDTGQGYKQLRAKLGMRRVRPWRWMPFTNPARSDGAVFHHWKRITDEARDYPFAKFNKQVPVPTYTDNEYLQH
LHNDSWSRQETDHLFDLCRRFDLRFIVIRDRWDRSRFPDRSVEDLKERYYDICAVLNKLKAGSSHETKVYVFDADHERRR
KEQLKRIFERTSEQIEEEQTLINELKRIEARKKEREKKQQDLQKLITAADNQAETRKSEKKLTKKKLQHQIRPRIDPNVV
ETAGIKFPDFKGSGVSLRSQRMKLPASVGQKRTKAIEQLLQELFIELNPMPTEDICVHFNELRSDMVLLYELKTALATCE
YELQTLRHQYEALNPGKTLVVPTSISGNREAPQNYVSAESDTTRQKGISEIIDVVGSPGTPNLT
Swiss-ProtDNA methyltransferase 1-associated protein 1
KEGG     K11324     
PfamPF05499  DMAP1; DNA methyltransferase 1-associated protein 1 (DMAP1)     
CoilsCoil
ProDomPD492828     
PANTHERPTHR12855:SF10

You might be interested in these researchers

You might be interested in these references