Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR19704.1 |
| sequence |
PEP: >KDR19704.1 MHILILVRADYWKSQAKKFCEYCKCWIADNIPSVEFHENGKRHKENVKRRLSEIGKKSRQEHQKSIKVDAQIKKMEEAAL |
| Swiss-Prot | WW domain-binding protein 4 |
| KEGG | K13220 |
| SUPERFAMILY | SSF51045 WW domain superfamily |
| Gene3D | G3DSA:2.20.70.10 |
| Pfam | PF06220 zf-U1; U1 zinc finger |
| SMART | SM00456 |
| ProSiteProfiles | PS50020 WW_DOMAIN_2; WW/rsp5/WWP domain profile. |
| Coils | Coil |
| ProSitePatterns | PS01159 WW_DOMAIN_1; WW/rsp5/WWP domain signature. |
| PANTHER | PTHR13173 |
You might be interested in these researchers
You might be interested in these references
