Gene detail [Fasta]
| Species | Bactrocera cucurbitae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011177070.1 |
| sequence |
PEP: >XP_011177070.1 MDLVADNESEVLCEKIINDIHAVFLKDPDLSTFEIIPTILNRNKSPVVHAEHHLGLESWCMKHVYDHSHKAIIGYRRQHQ |
| Swiss-Prot | Protein prenyltransferase alpha subunit repeat-containing protein 1 |
| KEGG | K14137 |
| SUPERFAMILY | SSF48439 Protein prenylyltransferase superfamily |
| Gene3D | G3DSA:1.25.40.120 |
| Pfam | PF01239 PPTA; Protein prenyltransferase alpha subunit repeat |
| ProSiteProfiles | PS51147 PFTA; Protein prenyltransferases alpha subunit repeat profile. |
| PANTHER | PTHR11129 |
You might be interested in these researchers
You might be interested in these references
